PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05739.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 250aa    MW: 28789.6 Da    PI: 9.983
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05739.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.21.3e-1181117339
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                              ++k +rr+++NReAAr+sR+RKka++++Le+   +L 
  Rsa1.0_05739.1_g00004.1  81 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 117
                              6899**************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-579142IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77281123IPR004827Basic-leucine zipper domain
PfamPF001701.6E-881112IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-783119No hitNo description
CDDcd147083.83E-2383134No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-785111No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
PfamPF141443.7E-29169243IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MNSASTHFVP TSRVGIYEPL HQFGMWGETF KNNIGNGGSM NTPNHILIPN NQKLDNTNLS  60
EDTSHGTPHM FDQEASTSRH PDKIQRRLAQ NREAARKSRL RKKAYVQQLE TSRLKLIQLE  120
QELDRARQQG FYVGNGIDTS SLGFSETMNP GIAAFEMEYG HWIEEQNKQI CELRTVLHGH  180
VTDVELRSQV ENAMKHYFEL FRMKSAAAKA DVFFVMSGMW RTSAERFFLW IGGFRPSDLL  240
KVIKIRKQRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5320570.0FJ532057.1 Brassica rapa subsp. pekinensis TGA2 protein (TGA2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150603.11e-177PREDICTED: transcription factor TGA1
RefseqXP_009150604.11e-177PREDICTED: transcription factor TGA1
RefseqXP_013643089.11e-177PREDICTED: transcription factor TGA1
RefseqXP_013643090.11e-177PREDICTED: transcription factor TGA1
RefseqXP_013643091.11e-177PREDICTED: transcription factor TGA1
SwissprotQ392371e-168TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A078F2R71e-177A0A078F2R7_BRANA; BnaA06g24140D protein
TrEMBLE6Y8B71e-177E6Y8B7_BRARP; TGA2 protein
STRINGBra024366.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-169bZIP family protein